DPCstruct | MC9279
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 94 ± 11 aa |
| Standard deviation of domain lengths | 10.62 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 53.59 |
| Pfam Score | 87.27 |
| Assigned Pfam label(s) | PF04563- PF04561 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9WUG5 | 163-260 | RAKGLLCEVKSIVEGSLNKPRTLQLIMQYRNKGPGSGFESLQCRVAQMDETIPLFVLFRAMDMVADKEILQTVVPDLKDAAMLELLR… |
| A0A2U1KZL7 | 1-82 | MAESQNRLSSTMFVRMLTRTSAKGGSSGQYIRATLPYIRTEIPIIIVFQALGFVADKHILGHIFYDFADTQMMELLRPSWKK |
| A0A448WYV0 | 229-332 | None |
| A0A3L6GAM4 | 45-112 | None |
| A0A183WT84 | 18-121 | None |
| A0A2A2KTH8 | 64-164 | None |
| U5DGA1 | 1-86 | None |
| A0A6V7YD68 | 8-102 | None |
| A0A0N1NVV2 | 246-347 | None |
| A0A1D6KX16 | 65-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.