DPCstruct | MC9278
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Standard deviation of domain lengths | 5.76 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 65.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q5D5H0 | 82-160 | IEFLAVLKRVKEIKGPILCLVGPPGVGKTSLAKSMARAVGRDFVRIALGGVRDESEIRGHRKTYIGSMPGKIIQHMKKA |
| A0A2U1KY33 | 62-130 | AKSPVICFVVPPGLVKTSLASSIAAALCRRFVQISLDCMKDEADIRRHRRTYIGSMPGHLIDGLKSCEI |
| A0A6S7NDC2 | 198-264 | None |
| A0A496SGT7 | 345-423 | None |
| K3WZ13 | 1-68 | None |
| A0A381KMM7 | 61-130 | None |
| D8QWE9 | 296-364 | None |
| A0A3L7HZM2 | 478-549 | None |
| A0A183FKT6 | 22-87 | None |
| X1AS17 | 37-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.