DPCstruct | MC9277
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 134 ± 12 aa |
| Standard deviation of domain lengths | 11.87 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 60.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K3YU09 | 172-318 | MAWQFSCDKCMELSGNTNPSFGGVLCANHSSLEHFLIGNSYSSGPIFVGLSSIGSMGFLRNPKAFLMVLKVAIELTDYRFILFSSGY… |
| A0A2U1KXQ6 | 22-150 | MEWQFSCKQCAEVTVLTSSENWNMKAELCSSHTELQKFLNASASLPPVFIGLSSIGSMGFMRKPQLLLRVLQSVIELSSYHFILFSS… |
| M0XHF2 | 1-147 | None |
| A0A287TZ55 | 1-132 | None |
| A0A287TYZ2 | 72-218 | None |
| D8QSI3 | 333-469 | None |
| M0XHF6 | 53-199 | None |
| A0A835HQU5 | 44-170 | None |
| A0A453NQR4 | 1-129 | None |
| A0A453NRD1 | 72-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.