DPCstruct | MC9276
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 114 ± 12 aa |
| Standard deviation of domain lengths | 11.53 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.84 |
| Pfam Score | 91.18 |
| Assigned Pfam label(s) | CL0123- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6QBB1 | 174-255 | WNPSGARRPVLEEAPVFYPSEEEFKDTLKYIESIRSTAEPYGICRIVPPPSWKPPCLLKEKNIWECSKFCTRVQKVDKLQNR |
| A0A2U1KUP3 | 9-127 | ACWRPEEDCRPVVDYTTVFRPTEEEFKDIYKYIEKIRPKAKEYGICRITPPNSWKPPFLIKGNQFDATRFGTHVQEINALKDLHSKR… |
| A0A182G1I6 | 68-185 | None |
| G4LUD8 | 1-117 | None |
| A0A803JP18 | 3-90 | None |
| A0A803J4M5 | 1-110 | None |
| A0A6J1X2E3 | 13-134 | None |
| A0A3Q0KQW7 | 1-118 | None |
| A0A6V7YDI6 | 12-122 | None |
| A0A1S3J398 | 10-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.