DPCstruct | MC9275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 88 ± 13 aa |
| Standard deviation of domain lengths | 12.88 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0DWB2 | 38-119 | EEEKFNETIDKGSEILASYIEELKSNNEKTLSGENAFRLYDTYGFPVDLTKEILEEEHLEIDEEGFQAEMEKQRQTARDARG |
| A0A7J7ASJ5 | 307-392 | RAEEERFFETLAIGMEILDSALAGDAKLLPGDVAFKLHDTYGFPLDLSNDVARERGVAVDEAGFNAAMAQQKTQARAAGKFKMDKA |
| A0A380QCL3 | 191-273 | None |
| A0A5B8MMV0 | 634-722 | None |
| A0A5A9NS70 | 257-364 | None |
| A0A835RAS9 | 441-537 | None |
| A0A7Y3NHJ6 | 189-271 | None |
| A0A139XL69 | 167-239 | None |
| W5MLK9 | 53-162 | None |
| A0A212DJT9 | 132-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.