DPCstruct | MC9272
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 128 ± 19 aa |
| Standard deviation of domain lengths | 18.97 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 63.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.25 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 39.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A072TJ36 | 7-124 | RESSKRRANRFIINVTTLMTVMVKRATLKLKAAPMTSEVKSPKKLLKNISNKAMPFIEKMKKKKKGKLEWGDGGVWQKTILMGDKCE… |
| A0A2U1KLM2 | 1-118 | MSSHNSTAFIQSIKTLLIVCAKQVIIASKKLRSSKLSKGSPKKLITSISSKTIKLGQRKKRNGVGDDGVWRKQILMGDKCQPLDFSG… |
| A0A6J1EAJ9 | 13-165 | None |
| A0A5E4ER63 | 1-149 | None |
| A0A6P5N0P0 | 1-137 | None |
| A0A4S8IM56 | 51-185 | None |
| A0A4D9BNR0 | 1-146 | None |
| A0A427A4A5 | 2-148 | None |
| A0A835EK96 | 1-129 | None |
| A0A438JYU7 | 18-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.