DPCstruct | MC9271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 114 ± 7 aa |
| Standard deviation of domain lengths | 7.46 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 38.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1NYJ1 | 1-111 | MPNFEQLKEVCGSNELKDCFKFVFAQDESENYGLITKITDLCNGLRQKISKFPDLIDEGQCISHFDATACVGLECLEKAQARNGDIL… |
| A0A2U1KL07 | 2-116 | ADTPNINELREACGSDELYHVFTFLESQDMTEDEGFLIRMGDESTKLRAKIDKRNDTIDEAWSFGPDNEVAKAGEHCLVEFQVRDRR… |
| A0A6L2JMV7 | 360-477 | None |
| A0A2U1NHM3 | 10-123 | None |
| A0A2U1N7Y7 | 10-129 | None |
| A0A2U1N2Q8 | 2-117 | None |
| A0A2U1NIC2 | 105-214 | None |
| A0A2U1MJ03 | 1-98 | None |
| A0A2U1QNZ3 | 11-123 | None |
| A0A2U1N1C7 | 37-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.