DPCstruct | MC9270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 74 ± 6 aa |
| Standard deviation of domain lengths | 5.69 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 44.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A200QPG2 | 237-309 | MKKEPNQNYFNPLYLIPKYFNAWLDLFRGIFAGIKLGKDFQESLVSILFRMVGLFVPGLASHSPRDTVNSARL |
| A0A287K817 | 63-133 | DEPDPNYFDPRYVLSKYGNAVGDLLKAAFLWASAGSDYREGICSLAYRCGGLIFPGFASHSPRDYVDAVRL |
| A0A2I0KML7 | 106-177 | None |
| A0A835HCB9 | 75-147 | None |
| A0A314YBT8 | 52-124 | None |
| A0A5K0WTG6 | 1-85 | None |
| A0A1S2Z8W8 | 38-112 | None |
| A0A0D2ZWU9 | 1-63 | None |
| A0A5N5G6R5 | 314-388 | None |
| A0A822XK96 | 151-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.