DPCstruct | MC927
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 92 ± 8 aa |
| Standard deviation of domain lengths | 8.06 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 19.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V6J238 | 129-220 | FKRNKKQITCVAGNKVSYVLPQMINKDNIDDSVEIKFRVREPLTNKKILIKLNEEVLKEIKRPNLAPAEMQTIMVKAEEFTSDFGEL… |
| A0A7W7WEW1 | 319-410 | PAGQVRLVADEPFRWVSPEILRPGDPAPARRRLLLWSDRYIPFPRIVLRQDGKVVGRRRLWWPAAPGRVFRIPTGILAGVDPQGGTV… |
| A0A174GHI8 | 2-86 | None |
| A0A6M8UBP9 | 307-403 | None |
| A0A7K2XP66 | 71-163 | None |
| A0A7C7EAG7 | 101-193 | None |
| A0A7X5WYC6 | 6-97 | None |
| A0A7K0IFG1 | 393-483 | None |
| A0A7J3D3G2 | 341-418 | None |
| A0A7C0VTS9 | 7-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.