DPCstruct | MC9269
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 86 ± 15 aa |
| Standard deviation of domain lengths | 15.22 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 57.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287G6K5 | 173-263 | NPDGTPLDKFNALGSNTQESLIQQYLEFLNVGCREELQQLKGIGEKRADYILELREDSPRPFRSLSDLGNIGLSTKQIQDILRKTAT… |
| A0A2U1K9M6 | 1-75 | MKPLSTLAQEYINFLNTASKVELMQLKGIGEKMADYILELRDTSPLKSLNDLEKIGLSSKQAGNMFGRTAKGLFD |
| A0A5N5KCB8 | 641-711 | None |
| A0A804Q3G6 | 423-544 | None |
| A0A2J6JJF6 | 574-650 | None |
| I6YMA1 | 590-665 | None |
| M1BAI0 | 354-441 | None |
| K7MI43 | 480-566 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.