DPCstruct | MC9268
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 111 ± 17 aa |
| Standard deviation of domain lengths | 16.94 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.98 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | CL0123- PF00439 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1K9M4 | 1-89 | MKKKRVWGTWEELILGGAVVRHGTHHWDLISDELRTRTLYPLFFTPEACRARYEDLQQRYTGCKYWYNELRDRRVAELKRELEKSEE… |
| A0A2N9EEU3 | 1-100 | MGREHGTSAQPWGTLEDLLLACAVNRHGTSSWDSIAMELQNRSSTTTLPLTPQYLKEKFDCIKRRFVAQKDDESDGIVDQLRRIRVE… |
| Q9ASW7 | 1-117 | None |
| A0A4P1RM67 | 2-91 | None |
| A0A1S3ZFU7 | 1-121 | None |
| A0A830CMQ7 | 8-96 | None |
| A9PIG8 | 1-131 | None |
| A0A068UR98 | 4-145 | None |
| A0A0A9E2D9 | 1-125 | None |
| A0A0D3H214 | 1-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.