DPCstruct | MC9267
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 144 ± 25 aa |
| Standard deviation of domain lengths | 25.41 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 40.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6L4N5 | 170-313 | MPKPANTAGQILQWLRDTSKNIITEVESKENDNSKYRCISANSMYRITQTLILSYSANMEQVSQEELFLQLSSMVADILAACLTNLP… |
| A0A5N6MAN0 | 32-172 | WLGDEAEKIMKKFMSKRKSSIDQSPYKFILASSMYPTSKTLLMHFNEQKNWLNDEELYEGISTIIADVLLACFTNLPRVIRMKCHHN… |
| A0A4D9AR36 | 286-457 | None |
| A0A2U1M9J1 | 14-152 | None |
| A0A7I8J985 | 9-172 | None |
| A0A2U1Q0A2 | 1130-1271 | None |
| A0A2U1PJR9 | 518-658 | None |
| M1A0Z1 | 139-310 | None |
| A0A078J5H2 | 11-124 | None |
| A0A5N6LLJ2 | 223-394 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.