DPCstruct | MC9265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 162 ± 13 aa |
| Standard deviation of domain lengths | 13.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 68.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 36.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12787 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G6FH72 | 93-259 | FGLPALPWELPVSTVILLRAIADIARSEGEDIRNMEGRLACLSVFALGAGKDAGPSESAYFAVRAAISREVVKAAEYLSVRGLAEES… |
| A0A7W3XFU8 | 1-172 | MGIVSLPLELPIATTLILRSIAEIAQGEGEDLTRPEVSLACVQVFALGGGRAGSDNPAESSYFAVRAALAQSMSEATHFVTEQGVIG… |
| A0A1D8ADZ0 | 30-175 | None |
| A0A257PD42 | 2-135 | None |
| A0A6N6JGR5 | 64-218 | None |
| A0A0U5I328 | 31-203 | None |
| A0A380TG31 | 1-174 | None |
| A0A7Y7M6U0 | 57-210 | None |
| A0A2N2LS78 | 8-182 | None |
| A0A539CY01 | 1-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.