DPCstruct | MC9264
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 74 ± 7 aa |
| Standard deviation of domain lengths | 6.66 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 25.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09299 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W3XEM0 | 4-80 | DDRPCRDRRVLTHQGLRWRGLRFGSLALASLRRRLGPGAHAYIRIDPTDPTCAHVLDEGCGTWIRADLLPPFASDAG |
| A0A2V8RQ66 | 11-84 | LIGFVEYRTVSKSGIELFTLLYNNAALSLIRRALKPGERVKVKYDPNDISVIYVWDKTNIRFIPVPALDQDYTR |
| A0A378N258 | 89-159 | None |
| A0A175RDC6 | 142-221 | None |
| A0A1M6LLV5 | 247-319 | None |
| A0A1I7CRB0 | 1-90 | None |
| A0A379HEG4 | 30-104 | None |
| A0A444MAA7 | 125-198 | None |
| A0A855HKT3 | 127-193 | None |
| A0A256GDF9 | 228-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.