DPCstruct | MC9262
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 96 ± 9 aa |
| Standard deviation of domain lengths | 9.22 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183U383 | 3-81 | ACENGKIWRAIDAYDYVCVDQQRLFDISEDNKLGDSRIAENGCQPPYVPRNAFVGDEVCVTKEESKRIQTENDEQHSHM |
| A0A5B0WFC1 | 38-139 | FPSIWDGGKPAASAQNDCIEPYRWRLAVEGDHVCVTNDTFLAVLQDNQRAASRRNPNGGPYGADTCISGYVFRDAFPGDRICVEPST… |
| A0A821RDU0 | 12-104 | None |
| A0A1H8VSK9 | 9-108 | None |
| A0A7Y4W7A2 | 15-112 | None |
| A0A7Y4W6G1 | 58-154 | None |
| A0A820JH85 | 8-94 | None |
| A0A243RAN6 | 10-108 | None |
| A0A7I7NYB2 | 15-113 | None |
| A0A1G3XYQ8 | 27-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.