DPCstruct | MC926
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 91 ± 4 aa |
| Standard deviation of domain lengths | 4.07 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 93.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212TM82 | 241-330 | YRFNEGTRPEADSPQLQLLASGTAIHWALEAQRLLADDWGVAADVWSAPSWTELRRDALECDAARLEGEDRIPYVTRALAGAPGPVV… |
| A0A447QCH5 | 714-811 | IYKLETLEGSKGKVQLLGSGSILRHVREASQILAKDYGVGSDIYSVTSFTELARDGQDCERWNMLHPTETPRVPYIAQVMNDAPAVA… |
| X8FGK0 | 188-278 | None |
| A0A7S2BNG8 | 8-103 | None |
| A0A378N6J5 | 38-119 | None |
| A0A640K275 | 52-139 | None |
| A0A509BDZ5 | 15-100 | None |
| A0A562WCC1 | 1-90 | None |
| A0A6D0ENI6 | 81-172 | None |
| A0A833NUB4 | 55-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.