DPCstruct | MC9258
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 222 ± 30 aa |
| Standard deviation of domain lengths | 29.82 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2JSC7 | 421-662 | EDFFTILPEYRRCDMEKLTWKKATFGYITGHYSLNEDSKKCAFNRILAIGDAASLQSPLVFTGFGSLVRNLPRLATLLDTALKHDLL… |
| A0A5B6URV7 | 7-206 | DSPLPAAFNRVLQFGDASGIQSPVSFGGFGSLTRHLGRLSNGIYEAIDGDFLDSYSLSLLNPYMPNLSASWLFQRAMSAKKQSNVPP… |
| A0A7S2Z2M7 | 2-182 | None |
| T2JT36 | 33-234 | None |
| A0A1D6Q164 | 19-271 | None |
| A0A0E0QJ54 | 303-525 | None |
| A0A383V8C1 | 51-286 | None |
| A0A813GJ91 | 435-636 | None |
| A0A7S2PJ42 | 150-359 | None |
| A0A7S2AL86 | 8-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.