DPCstruct | MC9256
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 89 ± 7 aa |
| Standard deviation of domain lengths | 6.53 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 48.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B6UFE3 | 1-84 | MVERVITCVHSLRERLDETLLAHRNEILALHSRKGILQHHQIILEFEAILKENRKKLADGAFFEVLKASQKAFVLPPWVALTVR |
| A0A6A6MPU7 | 3-91 | NPKLGRIPSMRERVEDTLSAHRNELVSLLCRYVDQGKGILQPHTLIDEFDNIVGEDEARLGLRDGPFGEILKSAQEAIVLPPFVAIA… |
| A0A444EKI6 | 1-75 | None |
| A0A6N2LYC2 | 1-96 | None |
| A0A835H7Z6 | 1-86 | None |
| A0A426YFH0 | 3-89 | None |
| A0A1D6P843 | 1-99 | None |
| A0A446X5N1 | 1-92 | None |
| A0A540N695 | 26-123 | None |
| A0A6N2LI81 | 111-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.