DPCstruct | MC9255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 160 ± 24 aa |
| Standard deviation of domain lengths | 24.32 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R0GH19 | 30-173 | DGKREKEAKRIFLSLTKPLLVLGLDPKPLRLEHRARLRHLLRRLVNRQQWVAASGVLSAYMKGTLNDTSPHTNRLKFWALLELLKHV… |
| A0A5B6U8B9 | 12-147 | MRNKRKLDKRLKLSLTKPSHLLTLKYAHIRWENRQRLCCLLERLVKKHNWAEASGVLSLLLKGTSHDFSADLNRLKYSVAIRLLKYI… |
| A0A200QKW2 | 1-154 | None |
| A0A7J6VX68 | 1-158 | None |
| A0A2Z6MXV8 | 3-181 | None |
| A0A0A0KVM2 | 1-189 | None |
| A0A834XFR8 | 35-178 | None |
| A0A0K9QGG7 | 10-117 | None |
| A0A2J6KXC8 | 1-182 | None |
| A0A2P2KH69 | 9-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.