DPCstruct | MC9253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 92 ± 10 aa |
| Standard deviation of domain lengths | 9.86 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I1LWH1 | 1-79 | MKCQRWRSAYDEALKRFGRKGLGQEFITGNEAFIASGCQSRSDVCPRSAEELNFANVMVMAGMNAGLASTFMPYACRKS |
| A0A1L9QE14 | 1-115 | MINKRYLLFFYFVLLTLIVCPVRGEAETRDERRVRNCTAYKETYSKALTYIDETKLTQEFRAAHDAFLATGCLSNIPACPIFAEDLW… |
| A0A2N3KCZ2 | 95-175 | None |
| A0A1X4N5I4 | 81-159 | None |
| A0A1M3NP41 | 71-159 | None |
| A0A3C0FM82 | 61-156 | None |
| A0A0Q4PKT1 | 7-103 | None |
| A0A848E8H9 | 9-99 | None |
| A0A7W6IE90 | 49-141 | None |
| A0A0N0E7D7 | 26-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.