DPCstruct | MC9252
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 157 ± 15 aa |
| Standard deviation of domain lengths | 15.38 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P9HZA1 | 22-179 | LLADCESCFGLCCVALPFAASADFAVDKAGGQPCHNLRDDFRCSIHAQLRERGFPGCTVFDCFGAGQKVSQITYEGRSWREEPATAR… |
| A0A1L9QE04 | 5-167 | DLEPDCSKCAALCCVVFAFDKSESFGLDKAAGKECPNLETDNTCKIFEERVERGFPGCVSYTCFGAGQRVTQEVFGGASWREEPALK… |
| A0A6A0CEC1 | 95-248 | None |
| A0A0N0V3Z1 | 3-135 | None |
| A0A5B9DQS3 | 1-140 | None |
| A0A178HTY4 | 1-128 | None |
| A0A810LM22 | 7-170 | None |
| A0A367EV57 | 3-153 | None |
| A0A1G8U4P6 | 215-372 | None |
| A0A1Z8P3X0 | 11-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.