DPCstruct | MC9245
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 177 ± 22 aa |
| Standard deviation of domain lengths | 22.02 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01888 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A499UPF8 | 23-220 | LRHGWTTGACATAATTAAYTALLSGDFPDPVTIELPKGQRPAFALAAEELAADHAMAAVVKDAGDDPDVTHGALVRATVRALPPGSG… |
| A0A2P5K4P7 | 48-203 | GFTTGTTAAAAAKAAVLSLVKQVDSVSVPTPSGIRARLDVRTSKGKAQVEKISGDHESDATRGLIFRARAVPSSTTLLIANKGIGIV… |
| A0A845PWC7 | 12-188 | None |
| Q8TYG5 | 46-206 | None |
| A0A7G8C8G0 | 2-160 | None |
| A0A367ZXB8 | 16-193 | None |
| A0A0J1G9F6 | 14-172 | None |
| A0A417MJ73 | 20-186 | None |
| A0A0P9ZQH8 | 152-353 | None |
| A0A7J5H740 | 252-477 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.