DPCstruct | MC9244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 87 ± 5 aa |
| Standard deviation of domain lengths | 4.93 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 53.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0RY56 | 177-262 | YNGACCFDYGNAETSSTDTGNGHMEAIYYGTETFWGTGAGSGPWLMADLENGLFSGANVKNNPADPTITDRFFTALVKGQSNNWAL |
| A0A499UAE4 | 1-86 | MVTSGTHVNSGCCFDYGNSETDRKADAAGAMDAINFGTECWFGGCSGSGPWVQADLEWGLYSGGSQSWNPNQRAFPSKFVTAMLKN |
| A0A7S4R4P7 | 259-340 | None |
| W7TC56 | 172-259 | None |
| L7EVM6 | 183-282 | None |
| B5HUR3 | 3-93 | None |
| A0A7W9KPW1 | 2-90 | None |
| A0A395T9X0 | 541-623 | None |
| A0A553HUS4 | 170-258 | None |
| C7PZI6 | 327-415 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.