DPCstruct | MC9243
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 132 ± 30 aa |
| Standard deviation of domain lengths | 30.09 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 91.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 50.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R8H195 | 1-111 | MRHLRRGGTPCVAAHSTTRALYAAYDGPLYQVRRASDNTVKDIGVLSTGGYANAAAQDSFCAGTSCVITVIYDESGKGNHLAQAPRG… |
| A0A4V2AJF4 | 307-409 | YGAANNTCVAAHSTTRALLSAYSGALYQVKRADGMTKDIPVKSPGGYADSAQQDTFCAGTTCTIWRIYDQSGHGNFLEAETPESTVK… |
| A0A0A3XKD5 | 401-509 | None |
| A0A495TNN0 | 30-188 | None |
| A0A7S4R4P7 | 123-230 | None |
| W7TC56 | 1-190 | None |
| A0A2I0RY56 | 1-163 | None |
| A0A553HUS4 | 1-162 | None |
| A0A1C4RUF8 | 30-169 | None |
| A0A067SK68 | 63-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.