DPCstruct | MC9242
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 46 ± 3 aa |
| Standard deviation of domain lengths | 2.91 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 65.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B3T374 | 1-44 | MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQVI |
| F6I768 | 1-46 | MSRSLGIPVKLLHEAAGHVVTVELKSGELYRGSMIECEDNWNCQLE |
| A0A4X1V3C9 | 359-406 | None |
| A0A438G5I7 | 3-46 | None |
| A0A498MGA8 | 1-48 | None |
| A0A481SWQ2 | 1-43 | None |
| A0A368GI73 | 9-56 | None |
| A0A843WBS7 | 1-54 | None |
| A0A553RJ56 | 615-662 | None |
| A0A5C7I5G9 | 70-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.