DPCstruct | MC9241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 204 ± 19 aa |
| Standard deviation of domain lengths | 18.50 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F6I6N9 | 3-180 | CRCSNKPTIVNNGNNNSSSGWDWNQWSRHFSEIEQVESFASVLKFQLEGAIEREDFEDAAKLKMVIAEAMSMDNIAEIMSWLKNAID… |
| A0A438EYR9 | 65-255 | NLCCRCSNNPTIANNGNSSSSFGWDWNQWSRHFSEIEQAESFASVLKFQLEDAIEREDFEEAAKLKMAIAEAMSMDSVTEIMSQLKN… |
| A0A151SCI0 | 382-575 | None |
| A0A4U5P411 | 339-558 | None |
| A0A7J6VAW3 | 1-206 | None |
| A0A6U0EWU1 | 144-381 | None |
| A0A4D8YM58 | 493-690 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.