DPCstruct | MC9240
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 61 ± 1 aa |
| Standard deviation of domain lengths | 1.20 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 83.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 68.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D3A072 | 1-63 | MMGYSDSGKDAGRLSAAWELYKAQEELVKVTKQYGVKLTMFHGRGGMVGRGGGPTHLAILSQP |
| A0A833NWL9 | 64-124 | GYSDSAKDAGFMSANWAQYRAQEELTAIARKHGVQLTLFHGRGGSISRGGAPTQQALFSQP |
| A0A072VDV1 | 98-158 | None |
| A0A0L9UUR1 | 80-140 | None |
| A0A6D0J3I5 | 87-147 | None |
| A0A287LMD0 | 1-63 | None |
| A0A3Q7I1H6 | 75-133 | None |
| A0A6N2N478 | 168-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.