DPCstruct | MC924
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 91 ± 12 aa |
| Standard deviation of domain lengths | 12.02 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X0F0T9 | 10-95 | AEQAATWLAYALSEMGVEADVNGNEHVALVSVYTNLVVWTDGTYFSWWSGRLTKVARRRVYAYCPSDDPLTAARRVSMRLENLKRQ |
| A0A7W7RV15 | 5-100 | SLDETGAVDAAEELRDALAQHEITADVHDGYGLAVVAVWAGLLVWCDGQRFWWRTEWNARQRRPIYAWHPALEPVQAARRVALRYAD… |
| A0A5S4GPC5 | 48-138 | None |
| A0A1G8E3D7 | 3-84 | None |
| D2BBJ7 | 10-101 | None |
| A0A239NAQ5 | 52-137 | None |
| A0A6N7II89 | 27-118 | None |
| A0A6N7IAZ3 | 3-89 | None |
| A0A6N8G956 | 5-89 | None |
| A0A841CR63 | 1-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.