DPCstruct | MC9237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 73 ± 6 aa |
| Standard deviation of domain lengths | 6.48 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 94.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 58.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V3X4B2 | 135-208 | AGAIDCHVHLICPQLIPVALGAGVTTIIGGGTGPAEGTKATTVTPGAWHLARMLESLDCWPVNFALLGKGNTVS |
| A0A827F8V2 | 114-176 | AGGVDTHIHWICPQQAEEALTSGITTMIGGGTGPTAGSNATTCTPGPWYIYQMLQAADSLPVN |
| A0A3S4IUS0 | 1-76 | None |
| A0A024UWJ6 | 398-472 | None |
| A0A379FJW8 | 18-95 | None |
| A0A820VBS6 | 1-82 | None |
| A0A445JCH3 | 156-227 | None |
| A0A817LJ90 | 15-95 | None |
| C3ZHU4 | 323-381 | None |
| A0A090T3M3 | 57-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.