DPCstruct | MC9236
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 126 ± 11 aa |
| Standard deviation of domain lengths | 10.86 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 55.14 |
| Pfam Score | 86.54 |
| Assigned Pfam label(s) | CL0137- CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F6HZY2 | 22-151 | LLSDYKCGEPSMLFSVADTLNRAITMPGLGKQLRHGKRYRYVSSHDVVHWTRSFMPDLKRACKDHYSKHCWSTGFSLSFRIVALSPS… |
| A0A0R0GKH0 | 331-447 | LSGAIRVNPWNIDEVAEAMNSAVTMSEAEKHLRHEKHYKYISSHDVAYWARSFDQDLDRACREHYSKRYWGVGLGLGFRIVALDPTF… |
| A0A4S4E2S3 | 760-877 | None |
| A0A5J5BHJ5 | 363-480 | None |
| A0A7J7L4E0 | 2-146 | None |
| A0A4D9BN94 | 296-412 | None |
| A0A7J7LGC6 | 508-654 | None |
| A0A7J7LGP5 | 123-240 | None |
| A0A2J8A9G2 | 278-397 | None |
| A0A7J7LFX3 | 322-432 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.