DPCstruct | MC9235
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 126 ± 17 aa |
| Standard deviation of domain lengths | 16.90 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.78 |
| Pfam Score | 96.07 |
| Assigned Pfam label(s) | CL0027- CL0125- CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9TSG9 | 51-174 | LSKGIQAGEDVLPEESAEPTLPMFNKATLQQLQAMGFPLIRCQKALLATGNADAEAAMEWLFGHMEDPDTDAPIQPAGGVKEVTEAL… |
| D5A7V4 | 6-126 | LQPGEELLPENVQRGPSASEAIVSQLAAMGFPRLHCEKAAINTSNTGVEDAMNWLLSHTEDPDIDTPISTGRQNDTKLKPPVDEGLV… |
| G3IHE3 | 86-222 | None |
| A0A162IQG2 | 431-548 | None |
| A0A821JP84 | 119-263 | None |
| A0A445HQ21 | 653-781 | None |
| A0A820ZN25 | 52-164 | None |
| A0A421JUL4 | 539-631 | None |
| A0A654I0N5 | 52-187 | None |
| A0A6H5FYD8 | 89-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.