DPCstruct | MC9234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 145 ± 18 aa |
| Standard deviation of domain lengths | 18.39 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F6HSG9 | 10-151 | EVRKMIVLSLPPSNATSVAILDCNLDVSEVVRKAAYYVLANKFPLQSLSIKVRTIILQRGLVDRSAAVTKECVKLLKDEWLVKCRNG… |
| A0A7S3A7S6 | 66-190 | MMSYDSSPAVRKAALSFTMISTCSVAAFVRRCHDVREDVRKTALRILANRVHPQSLPIASRVEILRAGLHDRSSAVRKTCLEVLLRD… |
| A0A0D2Y2P1 | 232-406 | None |
| A0A7R9LNL7 | 71-236 | None |
| A0A183SHX3 | 204-380 | None |
| A0A183TGE5 | 143-311 | None |
| L1IG07 | 171-289 | None |
| M3K567 | 237-367 | None |
| Q54TZ8 | 229-364 | None |
| A0A6P7TYK6 | 3-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.