DPCstruct | MC9233
Metacluster Properties and Pfam Annotations
| Number of structural domains | 234 |
|---|---|
| Mean domain length (aa) | 106 ± 21 aa |
| Standard deviation of domain lengths | 21.06 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.12 |
| Pfam Score | 98.46 |
| Assigned Pfam label(s) | PF01253- PF02201 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W0E4B9 | 178-258 | KNTLGYFKLNRELQELFDLYADSRPNVVKEFYKYVTLNKLLNHTTGEVTCDEKLKNIFKKEYFDFNDIDEMIEDKLEIIDY |
| F6HQE8 | 18-112 | SDKVVIDVKKRGGYNKLCSLSPQLQKIVGAAELTGPQVVKKFWTYIQENSLQDPKNNRNIICDESLQELFHVDSINMFEMNKVLSKH… |
| A0A0M5MSV6 | 18-124 | None |
| D7L1W6 | 127-238 | None |
| A0A2I0I646 | 35-149 | None |
| A0A813BR12 | 987-1084 | None |
| A0A1E5R339 | 377-482 | None |
| A0A7J6PKV8 | 229-398 | None |
| H2ANB8 | 104-192 | None |
| A0A843XEI6 | 239-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.