DPCstruct | MC9230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 69 ± 5 aa |
| Standard deviation of domain lengths | 4.87 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 53.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6HIL5 | 103-167 | LVSHYSIRHWSALSGVDTELINVQGHVAPREKHAGSLLEGFYQTQVSTLTVKDNLLVAGGFQGEL |
| A0A287P9Z7 | 2-66 | QNYSVMHWSSLLRRGKEVLSVAGQVTPNQGGRPLSRVQISTMMVKDNLLAAGGFHGELICKVRRS |
| A5C2T0 | 171-244 | None |
| A0A453RWE2 | 148-221 | None |
| A0A453RI65 | 138-202 | None |
| A0A287WQQ3 | 50-123 | None |
| A0A287HJ59 | 52-126 | None |
| M1A6X3 | 40-99 | None |
| A0A453B1N3 | 3-76 | None |
| A0A287WBA2 | 48-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.