DPCstruct | MC923
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 105 ± 11 aa |
| Standard deviation of domain lengths | 11.03 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0526 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7RQ09 | 11-138 | GLCWDERDITDMEECRVDRAAWKPFLRRWSGEWLAVYDVEPHSAFEEPVSDGWLGFPPASAEQVAAAEARLGCVLPRSFREFLLTTD… |
| A0A7H8M635 | 8-112 | RTVDQWRRYLAEYSAEVLRVALEDDLHEVGDLQRSAGWLGFDGADEGRLAALEQRLGIRLPQSYRSFLAASDRWLNLGPFMWTMRTS… |
| A0A7Z0ER66 | 320-414 | None |
| A0A4Q8BL68 | 7-114 | None |
| A0A223QEU9 | 310-424 | None |
| A0A6C0GL25 | 117-233 | None |
| A0A1M7TTP2 | 3-104 | None |
| A0A3N4SNG0 | 5-114 | None |
| A0A0S7B825 | 6-91 | None |
| K9WKQ1 | 1-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.