DPCstruct | MC9228
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 80 ± 11 aa |
| Standard deviation of domain lengths | 10.76 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 44.79 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | CL0209- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M7C3A9 | 1-63 | MCAYKLVTVKFRWWGLQGRVEKFLHKQERRLFTNFHRQLFCWLDKWVDLSMADIRRMEEETQK |
| A0A287P6N6 | 1-80 | MTIYKLVITDAPIWGLGERLEDCLITGERALFLSCHRLCFAWIDEWYGMTMEQIREMERHTDLHLKKTLKQAAKPRSKNE |
| A7RKJ5 | 8-78 | None |
| A0A803XSA3 | 99-183 | None |
| A0A0K2VJ59 | 74-164 | None |
| A0A1I7YP12 | 48-148 | None |
| A0A819EC30 | 1-79 | None |
| F4X4F7 | 159-256 | None |
| A0A022RAK3 | 50-130 | None |
| A0A016W6L2 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.