DPCstruct | MC9226
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 118 ± 18 aa |
| Standard deviation of domain lengths | 18.15 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A643C6Z4 | 20-140 | LPYKYQVLAERFCSMDTIVGMLYNCSETVTFTKVKQGVQDMMRKCFEECSVGRIKTVYPGSYRFCQERYAPTFKDVGRKSDYQLTIE… |
| A0A287NY45 | 7-118 | TYEIVCELFNCFESSTGLLRMKRSKATFPIICSSIQNLAERRFTYGHIAQLKYIMPETIVINKILLRDDKTCCMKPDLQVNLLVDSV… |
| A0A7J7FS68 | 28-150 | None |
| A0A1D6P2H8 | 84-190 | None |
| D0NZ35 | 22-149 | None |
| A0A0L7QXA1 | 117-263 | None |
| A0A0R0JCV5 | 59-149 | None |
| B8BHL7 | 116-234 | None |
| A0A540K4D1 | 1-96 | None |
| R7QNS9 | 180-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.