DPCstruct | MC9225
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 64 ± 3 aa |
| Standard deviation of domain lengths | 3.29 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 80.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 50.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A2ZKU2 | 32-99 | PEAIEIKRILLFDEMSSCMKPDLHVSIILDAIDFGDNSKSETKNLTLRKVFRDRLVDYSKAHPEGDEI |
| A0A287NXQ5 | 1-64 | MPETIVINKILLRDDKTCCMKPDLQVNLLVDSVEDSAMQKGENCYFAMRRMFRQRLVDFLHETS |
| A0A7I8JT05 | 97-157 | None |
| A0A4S4EBH1 | 188-248 | None |
| A0A5N5ICW0 | 116-175 | None |
| A0A6P6GFJ6 | 231-292 | None |
| A0A7N2MK37 | 164-232 | None |
| A0A199UPR3 | 45-113 | None |
| A0A4S8K0X5 | 1-62 | None |
| A0A287NY45 | 61-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.