DPCstruct | MC9224
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 148 ± 17 aa |
| Standard deviation of domain lengths | 16.57 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0065 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W3JFV8 | 387-515 | MKESNPCATPISSATQCVSRLHAMLMGLKNAPSERLLQIFRSCSGDPTLPIAHRVKQMGEVFCHHYTQSTKDHSGYSIDYATKYLWL… |
| A0A287NUP2 | 5-177 | NNGNIISAENSSRDFSNLSCPKRVFETLASPAKTIKNMLTVPSSPSSPANGGSVKVVQMTPVTSAMTTAKWLHEVISSLPEKPSTKL… |
| A0A453RNW5 | 20-168 | None |
| A0A6P5RGL1 | 105-245 | None |
| A0A6A4WHR6 | 332-477 | None |
| A0A287WKF5 | 128-306 | None |
| A0A397CER1 | 333-521 | None |
| A0A2U1MJ93 | 155-296 | None |
| A0A453HZH0 | 1-149 | None |
| A0A0K9RM86 | 246-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.