DPCstruct | MC9223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 68 ± 3 aa |
| Standard deviation of domain lengths | 3.49 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 63.75 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | CL0036- PF16199 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534LJW5 | 474-536 | HMMPGLPGSDPDRDMESFRVLFEDPAYRPDFLKIYPTLVLPGTALHALWKSGRYTPLGTEEAV |
| A0A287NUK8 | 1-65 | MMPNLPNVGVERDMESLREFFENPAFRADGQKIYPTLIRGTGLYELWKTGRYRNYPPELLVDIVA |
| A0A835KZV0 | 294-361 | None |
| A0A7I8XDV9 | 476-542 | None |
| A0A359MZU8 | 11-69 | None |
| A0A0M8MY17 | 270-339 | None |
| A0A6A4GEZ1 | 185-253 | None |
| A0A2K1IS67 | 252-321 | None |
| A0A2J8A9Y9 | 68-133 | None |
| A0A2B4SIX6 | 146-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.