DPCstruct | MC9222
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 70 ± 3 aa |
| Standard deviation of domain lengths | 2.93 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 85.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 58.18 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF05278- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9KJ77 | 311-381 | AGYAPDEEINLYEEIKFEPSVMCEPIDKKITFRASQLEDGDIVCFQKSLPVESTEQFRYPDVPSFLEYVHN |
| A0A2I0IFZ5 | 119-187 | AGFGPNEEVDLYEEIKFVPFVMCELIDRAASFRTNQLEDGDIICFQKRFVGAAESCRYLTVPSFLEHIR |
| A0A0D9VVE2 | 146-212 | None |
| A0A2J6MB44 | 497-575 | None |
| A0A453HJ13 | 108-175 | None |
| A0A835F5P7 | 162-228 | None |
| A0A396HYP2 | 236-306 | None |
| A5CAP4 | 1-72 | None |
| A0A453CK26 | 182-249 | None |
| A0A834GW03 | 170-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.