DPCstruct | MC922
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 167 ± 31 aa |
| Standard deviation of domain lengths | 30.55 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.19 |
| Pfam Score | 82.54 |
| Assigned Pfam label(s) | CL0745- PF18147 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8D525 | 2-132 | IGHIKLPLKAMYTFCCAPINRRMPFVCTMFLKYTRQFSQGEVITFDWLCHQIGWPISPPKTILELVHLEAIHDVFDTYLWLFYRFPE… |
| A0A7S1Y9Q8 | 1-174 | FLCRQKDMRHIARLLTHIDLPIRDKYMLTMAPIKSNDSSAYATLQNFAFKQSRGEAAGVGRMSIKEPKTFDDVSHLCNVHDSLGLFL… |
| A0A7R9XXW6 | 7-278 | None |
| A0A0V0QPS7 | 1035-1203 | None |
| A0A1V8SM41 | 544-765 | None |
| A0A7R9U0V5 | 309-467 | None |
| A0A7S2R3E5 | 186-360 | None |
| A0A1J8QCX2 | 1-141 | None |
| C4JDL0 | 258-450 | None |
| A0A6A2YSU1 | 982-1133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.