DPCstruct | MC9219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 92 ± 8 aa |
| Standard deviation of domain lengths | 8.10 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 56.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0713 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287UQR6 | 247-341 | FLLSGMTPRTSIFFFSFATIKTVDDHCGLWLPGNILHALFNNNTAYHDIHHQLYGNKYNFSQPFFVLWDKILGTYMPYSLEHRKGGG… |
| A0A287NF45 | 1-87 | MFLTLCTVKAIDNHCGVCLLPRRLQSVWNGAAYHGVHHLPRGVRYNFSDLFFVTWDHVFGTHMPYAVEERPGGDGLVLKPLPPPKNN |
| A0A7I8IPR5 | 132-219 | None |
| A0A7J7MYU9 | 395-488 | None |
| A0A2I0A919 | 58-160 | None |
| A0A395IIT7 | 2-77 | None |
| A0A1E5UQS2 | 1-101 | None |
| A0A6J5VKK0 | 1-75 | None |
| M8C1G6 | 80-171 | None |
| A0A3L6TG13 | 594-689 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.