DPCstruct | MC9218
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 66 ± 4 aa |
| Standard deviation of domain lengths | 3.56 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 43.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D5NF91 | 10-74 | KLAWALVALLAVLHYDFWNWGDRSVVFGFLPIGLLFQALISIGAAVAWTLVVRFAWPTHIEEWAD |
| A0A5R8KJB3 | 1-68 | MRKLTWIIFWLLFALHHDFWWWNDGSIVLGFLPISLAWHIGFSIAAGSLWLFAIRHAWPSEIEAWADE |
| A0A2D5BS09 | 1-68 | None |
| A0A517T9L6 | 37-103 | None |
| A0A2V8J6I2 | 17-79 | None |
| A0A5B9M5V2 | 14-76 | None |
| A0A7Y5L725 | 7-67 | None |
| A0A381QNT7 | 1-65 | None |
| A0A832HC46 | 23-86 | None |
| A0A2V9JYK3 | 1-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.