DPCstruct | MC9217
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 125 ± 13 aa |
| Standard deviation of domain lengths | 12.81 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18722 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R0B8T9 | 15-140 | AYAAVLGWSPVTRALLKRKRKSKVRVDEGEDGGRAIQVEEGLATYVFGVAKEFEFFADQKPGDLSLTLLKNVRQFAKGYEVNASPLW… |
| A0A5R8KH87 | 20-137 | AKREELGALLKIKRKSKARIDEAEDGQRAGFLEEGISALIFQHAQGLRNLEGLERVDYSLLKLIPDLVRGYEVEKCALWEWEDAIIQ… |
| A0A560FMN2 | 282-428 | None |
| A0A6H3U8A6 | 242-380 | None |
| A0A1Q5AZ60 | 185-291 | None |
| A0A1I3NBW7 | 169-281 | None |
| A0A192IHS5 | 313-434 | None |
| A0A239ICZ6 | 120-231 | None |
| Q0RX21 | 189-315 | None |
| A0A242U815 | 49-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.