DPCstruct | MC9216
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 98 ± 4 aa |
| Standard deviation of domain lengths | 4.48 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 33.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A238Z6W9 | 2-96 | GEKKEGFIDALFDFSFSKFITPKIAGVWLIVAYLFESLIALGALLSSLNAGGTAFVSTLILVALILPVALIGTRITIEGMVSLVKIA… |
| A0A5R8K9V7 | 11-107 | EKNPGLTLFDAVFDLSFATPITPRVVKWLYIISIVAAGLVALSKILSGFSAGIMAGLVSLFIAPIVFIIYVLVARVTLEVALAIFQM… |
| A0A2W4MGQ5 | 3-109 | None |
| A0A7C1KWQ9 | 5-104 | None |
| A0A6M0LN90 | 2-101 | None |
| A0A852V0Q0 | 83-176 | None |
| A0A7V3RJA8 | 37-131 | None |
| A0A1V4MJ07 | 2-98 | None |
| A0A496UK94 | 1-93 | None |
| A0A1F9E7K0 | 47-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.