DPCstruct | MC9214
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 233 ± 26 aa |
| Standard deviation of domain lengths | 25.87 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 68.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 18.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10336 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| P53060 | 1-241 | MSEEEAHKTVEVDDVGVQLDEGDEEDLLEYDDELVEEQPSDARIRNVAETLMKSELPKVTVEYKDTTFLLFTSDDKNESNNPIICEN… |
| A0A1R1PUX7 | 221-430 | DHEITVRETDEVLEIEEIGDANESVRQESEVIAQESEDDEDVSEEVGKLTAPVTWMKHDEKWVRFLGKGSEIGEQDKFAQNALFETS… |
| A0A0L6V6A4 | 1-205 | None |
| A0A5N7CY83 | 268-495 | None |
| A0A1B7T7P0 | 1-219 | None |
| A0A1E4SJZ5 | 78-320 | None |
| A0A2T3AN28 | 225-477 | None |
| I2H3X4 | 1-283 | None |
| G8B7C7 | 299-494 | None |
| G4TUV0 | 235-501 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.