DPCstruct | MC9213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 85 ± 8 aa |
| Standard deviation of domain lengths | 7.61 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q8NIQ1 | 1-84 | MKPLVSPGLAKACTGLSLIGIVFLLVLSYLFSIEAETLMHDLVGSGLTGKQVAKTCLGAVVIYAVFFLFCGSQVIVSRYQKPVR |
| P0C5R9 | 1-84 | MRPVVSTGKAWCCTVLSAFGVVILSVIAHLFNTNHESFVGSINDPEDGPAVAHTVYLAALVYLVFFVFCGFQVYLARRKPSIEL |
| W9WYQ8 | 1-77 | None |
| A0A420HXQ4 | 1-84 | None |
| A0A178F4W7 | 309-391 | None |
| A0A512U640 | 24-108 | None |
| A0A3D8R145 | 1-94 | None |
| A0A0E9NJK0 | 49-150 | None |
| A0A261Y187 | 1-83 | None |
| A0A167VJS0 | 155-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.