DPCstruct | MC9212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 112 ± 22 aa |
| Standard deviation of domain lengths | 21.58 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I5RMW5 | 101-182 | GRFRGNNFVTIDEPGYYEVSRVDPSGSATIQAGSATIYAAPPYSTIYIQNNLIYGQRLESGHSTQAPDGVYGLAFASVAEAY |
| A0A7H4K3P1 | 2-91 | EVVQSLVVSSPVDTGAYRASHIVSIGSADYGVRGPETNAVQDAAIQAVKFKLGNLVYIQNNKAYAPRLENGWSDQAPQGIYNTTFTY… |
| A0A7H4MIJ6 | 27-115 | None |
| A0A2E8DZI9 | 1-144 | None |
| A0A562Q890 | 10-134 | None |
| A0A1H9Q3A1 | 136-224 | None |
| A0A538PSL0 | 8-123 | None |
| A0A376RKW0 | 12-123 | None |
| A0A2R2ISF6 | 1-152 | None |
| A0A3N5H0C2 | 2-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.