DPCstruct | MC9210
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 115 ± 5 aa |
| Standard deviation of domain lengths | 4.86 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3F5W8 | 15-129 | MIYNVNRVGVVSFGLAAGLSICAFFGLLGATLAPFSPLIALVVAFVMTPLMGLLTRGRYYIKQVDDGIAEPRYDAAGNASTTVYQCV… |
| A0A7H4JZ57 | 2-117 | LYNVNPVGMVAFLVSAGLSIAAFFGLLGSFLAPYSPLIALVLAFVLTPIMGLLTKGKFYIKSHDDGIKEPRYDAEGTPVATVYHCRV… |
| A0A0N1K6Z6 | 15-127 | None |
| A0A3S6Z2K8 | 373-492 | None |
| A0A855HWB0 | 1-106 | None |
| A0A7S4U7Z9 | 101-217 | None |
| A0A1U6IJV4 | 65-183 | None |
| A0A378DK03 | 253-367 | None |
| A0A1L3S013 | 468-587 | None |
| A0A833KPQ4 | 36-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.